PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018562
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 303aa    MW: 34582.9 Da    PI: 4.7119
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-46452PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.4e-1965118356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++++q++ Le+ Fe +++++ e++ + A+ lgL+ rqV +WFqNrRa++k
  Lsa018562  65 KKRRLSNHQVKSLEKIFEVDNKLDPERKVKVAQDLGLQPRQVAIWFQNRRARWK 118
                56689************************************************9 PP

2HD-ZIP_I/II1261.7e-4065155292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  kkrrls++qvk+LE+ Fe ++kL+perKv++a++Lglqprqva+WFqnrRAR+ktkqlE+dy+ Lk++ydalk++ ++Le+e+e++ +el 
    Lsa018562  65 KKRRLSNHQVKSLEKIFEVDNKLDPERKVKVAQDLGLQPRQVAIWFQNRRARWKTKQLERDYNLLKSNYDALKHNYHKLEQEKESIINELI 155
                  9***********************************************************************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-2040122IPR009057Homeodomain-like
PROSITE profilePS5007117.10360120IPR001356Homeobox domain
SMARTSM003892.1E-1863124IPR001356Homeobox domain
CDDcd000863.44E-1665121No hitNo description
PfamPF000461.4E-1665118IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-1967127IPR009057Homeodomain-like
PRINTSPR000315.5E-591100IPR000047Helix-turn-helix motif
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PRINTSPR000315.5E-5100116IPR000047Helix-turn-helix motif
PfamPF021832.6E-14120161IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MKRNFGCSDS LTHFLSHPLE GEMKAEEECL YNGEFQSMVD GSGSGSGGGD GEDYGGEETG  60
QFSDKKRRLS NHQVKSLEKI FEVDNKLDPE RKVKVAQDLG LQPRQVAIWF QNRRARWKTK  120
QLERDYNLLK SNYDALKHNY HKLEQEKESI INELIELKAK LHEETTERND EFENKENILF  180
LGSDPTNTNH EIYTSLNYEK TRKSLDLKDG FSDSDSSGVL NEENMNVSNA NGSSLLNIAT  240
FGLSSICSSS ATNSNHTEHI DPTRTYQEQS DPYLVSNVED ESCNIFLVDQ APNLCWYFRD  300
HTN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112120RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016460142.12e-68PREDICTED: homeobox-leucine zipper protein ATHB-6-like
SwissprotP466673e-47ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5
TrEMBLA0A103YD071e-175A0A103YD07_CYNCS; Helix-turn-helix motif-containing protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.18e-47homeobox protein 16